- Aquarium Supply
- Dog Leash
- Litter Cleanup & Sanitation
- Pet Bed & Furniture
- Pet Bowl & Feeding Accessory
- Pet Carrier & Travel Product
- Pet Clothing & Accessory
- Pet Collar
- Pet Food & Treat
- Pet Grooming Supply
- Pet Shelter & Cage
- Pet Toy
- Pet Training & Control Product
- Veterinary Equipment & Product Service
-
- 3D Printing Prototype
- 3D printing prototype is the quick, easy, cost effective way to turn great ideas into successful products. 3D printing is an umbrella term used to describe all additive manufacturing process
YI HITECH Limited [Verified]
More >> -
- Ladies Electric Scooters
- Model:MINI 48Brand Name:PikaboMax Range: 30 kmPlace of Origin: ChinaOrder & Delivery:Minimum Order Quantity: 10 PCSSupply Ability: 1500 PCS/DAYCertificate: CE, BIS, CMVRPayment terms:T/T, L/C
Jinhua Pikabo Scooter Co., Ltd [Verified]
More >> -
- Neoprene Strap Knee Support
- Color: Customized colorSample service: Accepted CustomizeBusiness type:Manufacturer,exportBrand name: JJ
Yangzhou Jiwei Sports Products Co., Ltd [Verified]
More >> -
- 26 Inch Electric Mountain Bike
- 1. 36v/48V 250W/350W Electric mountain bicycle, Hot style aluminum E-bike, bicycle 2. Aluminum mountain ebike 3. Factory directly 4. Supply 1000sets per week5. SHIMANO derailleur
Shenzhen Youku Bike Co., Ltd [Verified]
More >> -
- Children Indoor Playground
- Children indoor playground project for modern paradise theme. This is new design from 2017. Soft playground project already show on market for several years. At first just small soft toys and small slide. And then we start to make theme playground. From f
Guangzhou Cowboy Recreation Equipment Co.,Ltd [Verified]
More >> -
- Playground Equipment for Community Park
- It is suitable for School, Community park, amusement park, play center,etc.
Wenzhou Jiuyi Import&Export Co.,Ltd [Verified]
More >> -
- Thermal Oil Heated Reactor
- The Thermal Oil Heated Reactor is a container with physical or chemical reaction. Through the structural design and parameter configuration of the container, the heating, evaporation, cooling and low-speed mixing function required by the process are reali
Wuxi Hongdinghua Chemical Equipment Co.,Ltd [Verified]
More >> -
- High Quality Floating Fish Feed
- Model Number: Floating Fish feed 36% Brand Name: YATAI Key Specifications/Special Features: High Quality Floating Fish FeedSpecifications:Protein: 36% minMoisture: 10% maxAsh: 10% maxFat: 7%-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMe...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
More >> -
- Multiple Function Aquarium Filter
- Model Number: SYHQXN-004 Brand Name: SENYE Key Specifications/Special Features: Product parameters:Voltage: 220/240VFrequency: 50/60HzNoise: 30-50dB (A)Power line length: 100cmNet weight: 0.4-0.6kgMaterial: PCColor:blackPower consumption: 4/6/15...
Yiwu Senye IMP&EXP Co.,Ltd [Verified]
More >> -
- Blow moulding machine made round plastic fish bowl floral border beautiful appearance
- Model Number: WY038 Key Specifications/Special Features: Size: 500mLMaterial: PETOEM/ODM: yesVarious styles are available.You could design different artworks for the this fish bowl.Welcome you to inquire Shipping Information: FOB Po...
Xiongyihua Plastic Limited [Verified]
More >> -
- Fish Feed 36%
- Model Number: Fish feed 36% Brand Name: YATAI Key Specifications/Special Features: Fish Feed 36%Specifications:Protein: 36% minMoisture: 10% maxAsh: 10% maxFat: 7-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMethionine: 0.4% minSize: 1- 8...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
More >> -
- Magnesium chloride, snow melting salt 99%
- Model Number: Magnesium Chloride-137 Key Specifications/Special Features: Product name: magnesium chlorideOther names: magnesium saltPurity: 99%minAppearance: whiteCAS no: 7786-30-3EINECS no: 232-094-6Certificate: ISO, CE, CQC, MSDSPlace of orig...
Shenzhen Sunsky Technology Limited [Verified]
More >> -
- Water Quality Tank Filter
- Model Number: SYHQXN-003-#1822 Brand Name: SENYE Key Specifications/Special Features: Product parameters:Voltage: 220/240VFrequency: 50/60HzNoise: 30-50dB (A)Power line length: 100cmNet weight: 0.4-0.6kgMaterial: PCColor:blackPower consumption: ...
Yiwu Senye IMP&EXP Co.,Ltd [Verified]
More >> -
- Glass Fish Bowl for Home Decoration, Various Designs and Colors are Available
- Model Number: KB115FT,198-1 Brand Name: kredglass Key Specifications/Special Features: Sizes:KB115FT: 198:TD: 9.5cm MD: 11.5(H) 13cmTD: 6.4cm MD: 9.5(H) 10cmUse: pet productsSpecies: fishType: aquariumsTechnology: mouth-blownVarious designs are ...
Qingdao D&O Houseware Co. Ltd [Verified]
More >> -
- LED aquarium light, dimmable, high flux and penetration shine deeper into the tank
- Model Number: YGL-SZLED500A5-#445-#4483 Brand Name: EXCEED Key Specifications/Special Features: Special features:Used in bedroom, clubs to createthe cozyand sweet environment16 different colors and 4 setting modes for option to change the color ...
Exceed Electronic Co. Ltd [Verified]
More >> -
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
More >> -
- LED aquarium light, dimmable, high power with lens, high quality with 3 years warranty
- Model Number: YGL-A165W- e50 -#7904. Brand Name: EXCEED Key Specifications/Special Features: Electronic data:Powew: 165W Actual power: 120W Input voltage: AC85-265V Electric current: 520mA Lifetime: ≥50,000 hours PF: > 97% Power cord: doubl...
Exceed Electronic Co. Ltd [Verified]
More >> -
- Exotic Environments Hobbit Castle
- Model Number: HG-#5004 Key Specifications/Special Features: Shipping and payments:Shipping method:By sea, by air or by express as per buyers requestWe can accept your shipping agentPayment terms:30% deposit by T/T, 70% against copy of B/LL/C at ...
Quanzhou Hogao Arts And Crafts Co., Limited [Verified]
More >> -
- Hot sale aquarium fish tank with USB LED lighting for Christmas gift
- Model Number: WB-007 aquarium fish tank Brand Name: Yake Key Specifications/Special Features: Aquarium & accessory type: AquariumsFeature: Eco-friendly, stockedPlace of origin: Guangdong China (Mainland)Brand name: YKModel number: WB-007 a...
YAKE INDUSTRIAL CO.,LIMITED [Verified]
More >> -
- Cast iron WQ series submersible coupling sewage trash pump
- Model Number: Solid-submersible sewage pump-#5182 Brand Name: SOLID Key Specifications/Special Features: Cast iron submersible trash water pump is powerful enough to get the job done and compact to use in almost any setting, whether it's at ho...
Shanxi Solid Industrial Co.,Ltd. [Verified]
More >>